SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024616 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024616
Domain Number 1 Region: 803-813,891-902
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000549
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024616   Gene: ENSMODG00000019723   Transcript: ENSMODT00000025052
Sequence length 976
Comment pep:known_by_projection chromosome:BROADO5:3:36734316:36834626:-1 gene:ENSMODG00000019723 transcript:ENSMODT00000025052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFAVEETLESDWVAVRPHVFEEREKHKFVFIVAWNEIEGKFAITCHNRTAQRQRSGSRE
PAAVRGSAEAGPPPDSPGPRSAGGSPTSRGRGEPAAGRRSPSLRRSPAWAEGGAARSAHP
RGDALLRGPAAKAGDPTRAQASPSRKALGKRDAAAPGEAPGPSSVRVVSASGGAAEEIEV
LELVKEDEAAPTLLELPEPEPPAELDSPPEECSWAGLFSFQDLRAVHQQLCSVNSQLEPC
LPLFPEEPSGMWTVLFGGAPEMSEQEVDSLCYQLQVYLGHALDTCGWKILSQVLFTETDD
PEEYYESLSELRQKGYEEVLQRARRRIQELLEKHKNTESMVELLDLYQMEDEAYSSLAEA
TTELYQYLLQPFRDMRELAMLRRQQIKISMENDYLGPRRIESLQKEDADWQRKAHMAVLS
IQDLTVKYFEITAKAQKAVYDRMRADQKKFGKASWAAAAERMEKLQYAVSKETLQMMRAK
EICLEQKKHALKEEMQTLQGGTEAIALLDQLEADYYDLQLQLYEVQFEILKCEELLLTAQ
LESIKRLVSEKRDEVVYYDTYESMEAMLEKEEMAASLHLQREELQKLQQKARQLEARRGR
VSAKKAYLRNKKKVTVNKALRKLNSRTKESSENQPTKHTRMVKREKLQDEEERKSTWVSQ
ERQKTLDRLRTFKQRYPGQVILKSTRLRLAHARRKSVASPASSVDQPQSLPVTLKAEEKT
EEGEQGKEMLQSLQTKEAQRLAQLEEPSLAQLEATSLPPSGVTSELPHIAPLPLLTDNDL
TPGTVTVVPLPPPLPPSPPPPPPPPPPPPPPPPLPTTKDGPTEPLEKGLSKVEGEEKRIP
KSASAPSAHFFDSSQLVSARKKLKKTAEGLQRRRVSSPMDEVLASLKRGSFHLKKVEQRT
LPPFPDEDDSNNILAQIRKGVKLKKVQKEVLRESFTLLPDTDPLTRSIHEALRRIKEASP
ESEDEEESLPCTDWEN
Download sequence
Identical sequences F6XLS8
13616.ENSMODP00000024616 ENSMODP00000024616 ENSMODP00000024616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]