SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024780 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024780
Domain Number 1 Region: 295-424,679-794,1148-1261
Classification Level Classification E-value
Superfamily TPR-like 1.4e-95
Family Tetratricopeptide repeat (TPR) 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000024780
Domain Number - Region: 32-42
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0968
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024780   Gene: ENSMODG00000019858   Transcript: ENSMODT00000025218
Sequence length 1272
Comment pep:known_by_projection chromosome:BROADO5:5:279765915:279889680:1 gene:ENSMODG00000019858 transcript:ENSMODT00000025218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQECPGRGPQGPGIPRRYLVGNSPGPAPQAPPPPLPPPPLPRWRATGPYFRFRREQRSW
GGKMAAVVAAAVAAGVRGRSGLRPAPGPHWLLGLSVFLGIAARGASATTHWIVTEDGKIQ
QQVDSPMNLKHPHDLVILMRQETTVNYLRELEKQLVAQKIHIEENEDRDTGLEQRHNKED
PDCIKAKVPLGDLDLYDGTYITLESKDVSPEDYIDTESPVPPDLKKPDCTKILELPYSIH
AFQHLRGVQERVNLSAPLLPKEDPIFTYLSRRLGRSIEDIGHRIHEGLMKNSSSWVLYNL
ASFYWRIKNVPYQVVECAMRALHFSSRHNKDVALVNLANVLHRAHFSADAAIVVHAALDE
SDFFTSYYTLGNIYAMLGEYNHSVLCYDHALQAKPGFEQAIKRKHAVLCQQKLEQKLEAQ
HRSLQRTLNELKEYQKQHDHYLRQQEILEKHKLIQEEQILRNIIHETQIAKEAQLGNHQI
CRLGNQQHSLHCQWDQPVRYHRGDIFENVDYVQFGEDSSTSSMMSVNLDVHENQSDLSHS
SKSSPVPHSVLWVWGMESDAYRDKQHILWPKRTDCAESYPSVPPGDELPTYFLPPENRGL
RTRAEMDLGLLGGEAHSPDCSSAIGIRSTRTPYLEFKELDSHLDLKFKMPDDYARQILLS
RINNYTITEDEIGTLLFHAINKPNEPLWFMFNEAGLYWRALGNSTFAIACLQRALDLAPP
QYQDIPLVNLANLLMHYGLHHEASKLLLQALAINSSEPLTFLSLGNAYLALKNISGAIQA
FRQALNVTTRCLECEGSLKLVRCMQFYPFLYAAPSSACSGHCHESNQDSLHGREKYFDKP
EEALGATEDEPSGKGREEHPRISIENSGRDSDPLRLQSTVVAESNGSDGLESLSDTQMSE
EMLALVDEFENAWPLEAFEGALEVKGRRMDLQGIRVLKKGLQDGVASSSCFGDCGDDDDD
ETEWITFQVKRLKKPKVESSDSQEPPGKNNEEQIQAENEHRFQKTLEISGPKIPAPGPAG
KKPDYESLGWPSPDECVKLRRVELTTVASTWLAVSAKNIDITEHIDFATQLQEPAMEPLC
NSNLPASMHTLDHLHGVANRASLHYTGESQLKEVLQNLGKDKYPQQSFEQIGTRIAKVLE
KNQTSWVLSSMAALYWRVKGQGKKAIDCLRQALHYAPHHMKDVPLISLANILHNARLWQD
AIVVATMAVEIAPHFVVNHFTLANVYVAMEEFEKAMMWYESTLKLQPEFAPAKNRIRTIQ
CHLLMKKERRSP
Download sequence
Identical sequences F6RRA5
ENSMODP00000024780 ENSMODP00000024780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]