SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024822 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024822
Domain Number 1 Region: 271-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-17
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 2 Region: 232-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000174
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 326-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000605
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024822   Gene: ENSMODG00000019895   Transcript: ENSMODT00000025263
Sequence length 447
Comment pep:known_by_projection chromosome:BROADO5:5:283745885:283752368:1 gene:ENSMODG00000019895 transcript:ENSMODT00000025263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGLWRDVRVCEQSSGWASLVQQGRRKKEGNVTPVRIGERLHLQVSQTILPGCELLLWP
QSPSTGPGHAEEQPLTMESGSGLGTTVLTDGVSPEGDSTEPCTAISPQQGLANKKDTKQS
LEFGPKSQGDHMEEEGEKEEEREGRIAPLPDSPAEGTQLPQSNLSIGPGDLSPSNSSSSS
AAPGGAPRLSPRLANRSCKLFGPGSPRDRQAGEAEHSDLTKPPGGTARHSSRRYHCTVCS
KAFLQLCHLKKHQFVHAGHKPFLCTECGKSYSSEESFKAHMLGHRGVRPFPCPQCDKAYG
TRRDLREHQVVHSGARPFTCDQCGKAFARRPSLRLHRKTHQVPAAPTPCPCPICGRHLAN
QGSLRNHMRLHTVAWCRVSPWTDLSLYCLTGTRRRRSDGSWIWRGPPTTSSFGKLQVLMA
VWTVACSEPSCPQRPSWGASCPCTPGL
Download sequence
Identical sequences F6W5U6
ENSMODP00000024822 ENSMODP00000024822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]