SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024957 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024957
Domain Number 1 Region: 185-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 129-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 283-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 74-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 6 Region: 31-83
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.72e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024957   Gene: ENSMODG00000028147   Transcript: ENSMODT00000025399
Sequence length 347
Comment pep:novel chromosome:BROADO5:Un:52259754:52260797:-1 gene:ENSMODG00000028147 transcript:ENSMODT00000025399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTNSVEKSEKPGVTFGAFHLYSFQKSTNMYTGEKFYKCPQCRKAFNKSSKLILHQRIHV
GENTYECNVCGKGFHHRSKLSIHQRAHTRKNPYQCNDCGKMFINDSKLILHQRIHTGEKP
FKCNDCGKVFSHRSKLIIHQRIHTGEKPFKCDDCGKAFNQSSHLLQHQRIHTGEKPFKCH
DCGKAFNQSSNLLQHQRIHTGEKPFQCSDCGKAFNRSSHLFQHQRIHTGEKPFKCDDCGK
AFHQNSHLLQHQRIHTGEKPFLCHDCGKAFNWISNLLQHQRIHTGEKPFKCSDCGKAFNQ
NSNLFKHQRIHTGEKPFNCNDCGKAFNQSSNLIVHQRIHTEKVIKKS
Download sequence
Identical sequences H9H7J7
ENSMODP00000024957 ENSMODP00000024957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]