SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025019 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025019
Domain Number 1 Region: 44-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.32e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 100-157
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 156-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 198-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 7-58
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025019   Gene: ENSMODG00000020030   Transcript: ENSMODT00000025461
Sequence length 257
Comment pep:novel chromosome:BROADO5:4:413982326:413983096:-1 gene:ENSMODG00000020030 transcript:ENSMODT00000025461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AHTRKNPYQCNDCGKMFINDSKLILHQRIHTGEKPFKCNDCGKVFSHRSKLIIHQRIHTG
EKPFKCHDCGKAFNQNSYLLQHQRIHTGEKPFKCDDCGKAFNQNSHLLQHQRIHTGEKPF
QCHDCGKAFNQNSNLSVHQRIHTNERPFQCNDCGKAFNRSSHLLQHQRIHTGEKSFKCND
CEKAFNRSSTLLKHQRIHTGEKPFQCHDCGKAFSQNSNISVHQRIHTGEKPFQCNDCGKA
FKQSSHLLQHQRIHNGE
Download sequence
Identical sequences F7A7D4
13616.ENSMODP00000025019 ENSMODP00000025019 ENSMODP00000025019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]