SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025122 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025122
Domain Number 1 Region: 85-459
Classification Level Classification E-value
Superfamily Serpins 3.53e-89
Family Serpins 0.00000519
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025122
Domain Number - Region: 28-84
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0018
Family beta-sandwich domain of Sec23/24 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025122   Gene: ENSMODG00000020104   Transcript: ENSMODT00000025567
Sequence length 460
Comment pep:known_by_projection chromosome:BROADO5:5:291638264:291833621:1 gene:ENSMODG00000020104 transcript:ENSMODT00000025567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDRGQGNLGLKSISEDFSEYSTESTTQPSTQPPTEPPTQPTSQPTTQPTSQPTTQPTSQP
TTQPTSQPTTQPTSQPTTQAPPEPTCLEPDISCSETETQEAQNMLGAALTDFSLKLYHAF
SSVKKVDSNMVFSPFSIASLLTHILLGAGNTTKGNLKDVLSYPNDFDCVHQALKNLSSSG
FVSASQIFHSPGLALKETFVNASQTLYGSQPMVLSSDNAANLALINSWVANQTNNKITNF
LKNLPSDISLVLLNTIYLQAKWKIMFDPKKSLQESFYLKSSKVKVPMMKSEKYPVTHFTD
PNLKARVGLLQLSNDLSLVILLPRHFGLQLAEVELKLHNPVFSAIMEKLGKIKSYSTLLS
LPRLKVNTSQDLLEILEKMDFFPYDLNLCGLTDDLDVQVSGAHHQTVLELNEAGVEASAA
SSLSLARSMPIFEVNQPFIFLLWHQKYKFPIFMGRIYDPR
Download sequence
Identical sequences F7ERZ3
13616.ENSMODP00000025122 ENSMODP00000025122 ENSMODP00000025122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]