SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025130 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025130
Domain Number 1 Region: 14-19
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000706
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025130   Gene: ENSMODG00000020110   Transcript: ENSMODT00000025575
Sequence length 245
Comment pep:novel chromosome:BROADO5:5:291898890:291906582:-1 gene:ENSMODG00000020110 transcript:ENSMODT00000025575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENFSALFGTQTEPPPPPPAALGFGPGKPPPPPPPPPGGGPGTVPPPAAVPSAPGADKAA
AGCGPFYLMRELPGSTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLP
GSHDNSGLRSLIEKPPILGGSFNPITGTMLAGFRLHAGPLPEQCRLMHIQPPKKKNKHKH
KQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGMGSSQASS
SSSLR
Download sequence
Identical sequences F7EA17
13616.ENSMODP00000025130 ENSMODP00000025130 ENSMODP00000025130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]