SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025371 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025371
Domain Number 1 Region: 12-121
Classification Level Classification E-value
Superfamily POZ domain 2.55e-27
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 291-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000003
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 357-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000342
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 4 Region: 242-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000412
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025371   Gene: ENSMODG00000020281   Transcript: ENSMODT00000025822
Sequence length 583
Comment pep:known_by_projection chromosome:BROADO5:3:231392672:231427774:-1 gene:ENSMODG00000020281 transcript:ENSMODT00000025822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEETMECIQEFPEHHKMILDRLNEQREQDQFTDITLIVDGHHFKAHKAVLAACSQFFY
KFFQDFTQEPLVEIEGVSNMAFRHLIEFTYTAKLMIQGEEEANDVWKAAEFLQMLEAIKA
LEVRNKENSSPLEENTTAGKNEAKKRKIAETSNVITESLPSAESEPVEIEVEITEGTIEV
EDGLETLEEVASAEQSIKYIQSTGSSDDSALALLADITSKYRQGDRKGQIQEEDGCASDP
TSKQEHMKSHSTESFKCDICNKRYLRESAWKQHLTCYHLEEGGASKKQRPGKKIHVCQYC
DKQFDHFGHFKEHLRKHTGEKPFECPNCHERFARNSTLKCHLTACQSGVGAKKGRKKLYE
CQVCNSVFNSWDQFKDHLVIHTGDKPNHCTLCDLWFMQGNELRRHLKEIHNISERIVTEE
LLSVETVETEPVTSMTIIEQVGKVHVLPLLQVQVDSAQVTVEQVHADLLEDNQVQGTQVE
ELPEQVQVSYLEVGRIHTEEGTEVHVEELHVERVNQMQMEAQDDLLEDADLEQGDPEIMD
QGELEESKQTQADAAEASKEDHGQGEDLKTEPMVDGQTLKTQT
Download sequence
Identical sequences F7C0G0
XP_016287073.1.35504 ENSMODP00000025371 ENSMODP00000025371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]