SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025533 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025533
Domain Number 1 Region: 303-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000173
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 
Domain Number 2 Region: 553-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000394
Family HkH motif-containing C2H2 finger 0.062
Further Details:      
 
Domain Number 3 Region: 373-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000953
Family HkH motif-containing C2H2 finger 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025533   Gene: ENSMODG00000020412   Transcript: ENSMODT00000025985
Sequence length 1070
Comment pep:known_by_projection chromosome:BROADO5:3:244365643:244442581:1 gene:ENSMODG00000020412 transcript:ENSMODT00000025985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPICPVVSFTYVPSRLGEDAKMATGNYFGFTHSGAAAAAAAAQYSQQPASGVAYSHPTT
VASYTVHQAPVAAHTVTAAYAPAAATVAVARPAPVAVAAAATAAAYGGYPTAHTATDYGY
TQRQQEAPPPPPPATTQNYQDSYSYVRSTAPAVAYDSKQYYQQPTATAAAVAAAAQPQPS
VAESYYQTAPKAGYSQGATQYTQAQQTRQVTAIKPATPSPATTTFSIYPVSSTVQPVAAA
ATVVPSYTQSATYSTTAVTYSGTSYSGYEAAVYSAASSYYQQQQQQQKQAAAAAAAAAAT
AAWTGTTFTKKAPFQNKQLKPKQPPKPPQIHYCDVCKISCAGPQTYKEHLEGQKHKKKEA
ALKASQNTSSSSTSIRGTQNQLRCELCDVSCTGADAYAAHIRGAKHQKVVKLHTKLGKPI
PSTEPNVVSQATSSTAASASKSTASTSGIAASNSTVNSSVVTSAVKVLTPATNTGLNTAS
NTKASTVPASMAAKKTSTPKINFVGGNKLPSIKTEDLKGTESIKATPATSAVQTQEVKSD
PSDPVTPTTLAALQSDVQPVGHDYVEEVRNDEGKVIRFHCKLCECSFNDPNAKEMHLKGR
RHRLQYKKKVNPDLQVEVKPSIRARKIQEEKMRKQMQKEEYWRRREEEERWRMEMRRYEE
DMYWRRMEEEQHHWDDRRRMPDGGYPHGPPGPLGLLGVRPGMPPQPQGPAPLRRPDSSDD
RYVMTKHAAIYPTEEELQAVQKIVSITERALKLVSDNMSDHEKSKSKEGDDKKEGGKDRA
LKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPSKTLLSRISENLPKQLAVISPEKYDIKC
ALSEAAIILNSCVEPKMQVTITLTSPVIREENMRDGDVTSGMVKDPPDVLDRQKCLDALA
ALRHAKWFQARANGLQSCVIIIRILRDLCQRVPTWSDFPSWAMELLVEKAISSASGPQSP
GDALRRVFECISSGIILKGGPGLLDPCEKDPFDTLATMTDQQREDITSSAQFALRLLAFR
QIHKVLGMDPLPQMNQRFNIHNNRKRRRDSDGVDGFEAEGKKDKKDYDNF
Download sequence
Identical sequences F7BEA3
ENSMODP00000025533 ENSMODP00000025533 XP_001365789.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]