SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025563 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025563
Domain Number 1 Region: 1025-1075
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000584
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 904-956
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000562
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 3 Region: 784-823
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000411
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number 4 Region: 1172-1223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000567
Family HkH motif-containing C2H2 finger 0.057
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025563
Domain Number - Region: 842-889
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000106
Family Classic zinc finger, C2H2 0.053
Further Details:      
 
Domain Number - Region: 615-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000551
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 1265-1287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00138
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025563   Gene: ENSMODG00000020433   Transcript: ENSMODT00000026015
Sequence length 1301
Comment pep:known_by_projection chromosome:BROADO5:3:246692675:246772867:-1 gene:ENSMODG00000020433 transcript:ENSMODT00000026015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMGDMKTPDFDDLLAAFDIPDMVDPKAAIESGHDEHESHIKQNAHVDEDSHAPSSSDVG
VSVIVKNVRNIDSSEGVDKDGHHSTGNGLHNGFLTTSTMESYNKDGAKSLKDEGPAPEVK
LKETTFNQFSPISSAEEFDEDEKIEVDDPPDKEEIRSNFRANVLTGSISQQDYEKLKALG
GETLIKPGIPTPTTLDKNKVIKRETETNSITLGVYEPFKVRKVEDKLKENSEKLLDNRVL
DGKLTSEKNEASLASAAQSKAKSSAKLSSCIAAIAALSAKKAATDTCKEPVANSREPSPL
PKEINDSPRAVEKSPESQSLIDSAKKPSIKPPDSPRSVSSENSSKGSPSSPAGSTPAIPK
VRIKTIKTSSGEIKRTVTRVLPEVDPDSGKKPSEQTPSMVASVTSLLSSPTSATVLSSPP
RAPLQSAVVTNTVSSADLAPKQVTIKPVATAFLPVSAVKTAGSQVINLKLANNTTVKATV
ISAASVQSASSAIIKAANAIQQQTVVVPASSLANAKLVPKTVHLANLNLLPQGAQATSEL
RQVLTKPQQQIKQAIISAAASQPPKKVSRVQVVSSLQSSVVEAFNKVLSSVNPVPVYIPN
LSPPANAGITLPTRGYKCLECGDSFALEKSLTQHYDRRSVRIEVTCNHCTKNLVFYNKCS
LLSHARGHKEKGVVMQCSHLILKPVPADQMIASPSSNTSTTSSTLPSSAGGGTHNVTKIQ
SGITGTVISAPSSTPIVPAMPLDEDPSKLCRHSLKCLECNEVFQDETSLATHFQQAADTS
GQKTCNICQMLLPNQCSFASHQRIHQHKSPYTCPECGAICRSVHFQTHVTKNCLHYTRRV
GFRCVHCNVVYSDVAALKSHIQGSHCEVFYKCPICPMAFKSAPSTHSHAYTQHPGIKIGE
PKIIYKCSMCDTVFTLQTLLYRHFDQHIENQKVSVFKCPDCSLLYAQKQLMMDHIKSMHG
TLKSIEGPPNLGINLPFSIKPTTQNSASHNKEDPKSVNGKEKLEKKLPSPVKKVAEPKKV
ANPGWTCWECDRLFTQRDVYITHMRKEHGKQMKKHPCRQCDKSFSSSHSLCRHNRIKHKG
IRKVYTCSHCPESRRTFTKRLMLEKHIQLMHGIKDPDLKEMTESTSVEETEIKEETKAPS
PKRKLEEPILEFRPPRGAITQPLKKLKINVFKVHKCAVCGFTTENLLQFHEHIPQHKSDG
SSYQCRECGLCYTSHVSLSRHLFIVHKLKEPQPVSKQNGSGEDNQQENKPSHEDESSDSL
MSDRKCKVCAKTFETEAALNTHMRTHGMAFIKSKRMSSAEK
Download sequence
Identical sequences F7AR81
ENSMODP00000025563 ENSMODP00000025563 XP_007487579.1.35504 XP_007487580.1.35504 XP_007487581.1.35504 XP_007487582.1.35504 XP_007487583.1.35504 XP_016287116.1.35504 XP_016287117.1.35504 XP_016287118.1.35504 XP_016287119.1.35504 XP_016287120.1.35504 XP_016287121.1.35504 XP_016287122.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]