SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025686 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025686
Domain Number 1 Region: 342-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000173
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 375-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000125
Family Classic zinc finger, C2H2 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025686   Gene: ENSMODG00000020530   Transcript: ENSMODT00000026143
Sequence length 413
Comment pep:known_by_projection chromosome:BROADO5:5:185852427:185893635:-1 gene:ENSMODG00000020530 transcript:ENSMODT00000026143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYTPRQPRVPQPLCFLEAMQQQQQQQPHYASERAAPPFLPLGPWAVLQQQTKHQKSILE
DLTKRMLMFDPVPVKQEAMDPVSVSYPSNYIEQMKSNKYSVIYSTPNMLHNKFYPTPEGL
SNGIQMEPVDLTVNKRSSPPSAGSSPSPLKFQTSHRRASPGLTLPSPSPPMKKFTPPPPG
VQPFSVPLSIPPVMAALSRHGIRSPGILPVIQPVVVQPVPFMYASHLQQPIMVSTVLADE
LDNASSMQVPVIESYEKPILQKKIKVEPGIEPQRTDYYPEEMSPPLMNSVSPPQVPLLQE
NHPSVIVQPGKRPLPVESPDTQRKRRIHRCDYEGCNKVYTKSSHLKAHRRTHTGEKPYKC
TWEGCTWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV
Download sequence
Identical sequences F7ENG6
ENSMODP00000025686 ENSMODP00000025686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]