SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025747 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025747
Domain Number 1 Region: 142-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.82e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 3-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-16
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 3 Region: 208-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.28e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 86-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000142
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025747
Domain Number - Region: 246-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000918
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025747   Gene: ENSMODG00000020585   Transcript: ENSMODT00000026207
Sequence length 279
Comment pep:novel chromosome:BROADO5:5:180905365:180907019:-1 gene:ENSMODG00000020585 transcript:ENSMODT00000026207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQLLTFKDVIVDFIQEEWDHLDPVQRGLYKIMILKNYQNFIFLGFPISKPEDSTFETKNS
TLEESNYMGELSMRRLTVNTNECGETFRQMEHLIIHQRFQTGEELYQCNDCEKALNCNSA
FKHQRNHTREKFYKCNNGEKDFRQRGHLTDHKKMHTREKSYSCNGCGKTFIQKANLAVHQ
KIHTGEKPYKCNICIKFIPEKTPTNAIFLHHRIHIGEKLFTCNECEKTFRQRGTPDDNQR
VHTGEKSYKCNECSKIKPSEKTYLTIHKIHTGKKSYKCE
Download sequence
Identical sequences F7A151
ENSMODP00000025747 13616.ENSMODP00000025747 ENSMODP00000025747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]