SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025845 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000025845
Domain Number - Region: 333-396
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0128
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025845   Gene: ENSMODG00000020654   Transcript: ENSMODT00000026306
Sequence length 528
Comment pep:known_by_projection chromosome:BROADO5:5:172487930:172581877:-1 gene:ENSMODG00000020654 transcript:ENSMODT00000026306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGEVERLVSELSGGTGGDEEEEWLYGDENEVERPEEENASANPPSGIEDETAENGISK
PKVTETEDDSESDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNLNIKTGGRVYGAAGTK
VKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRI
RMGLELIPNKITAEDYTMEVTPGAEIQDGRYNLFKVQQGRTGNAEKETVLQSAKAEFTSP
PSLFKTGLPPSRNSASSQSQTSSASRKANSGIGKWQDRYGRAESPDLRRLSGTIDVIGQT
ITISRVEGRRRANENSNIQVLSERSAAEVDNNFSKPPPFFPPGAPPTHLPPPPFLPPPPT
VSTAPPLIPPPGIPITVPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRSARAFPYGNVAF
PHLPGSAPSWPSLVDTTKQWDYYARREKDRERERERDRERDRDRDRERERTRERERERDH
SPTPSVFNSGTSTKVERPSTCSNNRAISRKGHIMIRENNINFSKFKKK
Download sequence
Identical sequences F7E5Y1
ENSMODP00000025845 ENSMODP00000025845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]