SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025896 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025896
Domain Number 1 Region: 293-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 333-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000341
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 3 Region: 249-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000999
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025896
Domain Number - Region: 159-183,216-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00327
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 393-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00357
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025896   Gene: ENSMODG00000020702   Transcript: ENSMODT00000026358
Sequence length 604
Comment pep:known_by_projection chromosome:BROADO5:5:168737445:168770149:-1 gene:ENSMODG00000020702 transcript:ENSMODT00000026358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMATQVLGQTGGNGLFTGNANIVMALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNG
GCCDYMVGEERQMAELTTVGDNNFSDSDGEGLEGPPGIKNESNRPENMELGSLEIIVVDP
QTVYESSAPETFSSEKDPPSEIPYQPETSEDKCKSLKSKPFRCKPCQYEAESEEEFVHHI
RVHSANKFFAVENAEKQAQQAQTKESDSSVAEEADFSKGPIRCDRCGYNTNRYDHYLAHL
KHHNKAGENERVYKCMLCTYTTVSEYHWKKHLRNHFPKKVYTCSQCSYFSDRKNNYIQHI
RTHTGERPYQCVMCPYSSSQKTHLTRHMRTHSGEKPFKCEQCNYVASNQHEVTRHARQVH
NGPKPLTCPHCDYKTADRSNFKKHVELHVNPRQFLCPVCDYAASKKCNLQYHIKSRHSDC
CDIAMDVSRVKLKKSKKSEADHCSCNSVANEKGEKEQTKTKGDMMEKINEKNIKVEKKEN
ASKEKKPCSVGQVTTRNRKLATESKEIDVKLEKGSEKSCKNKKVKRKMESEAASLNSNPV
NDLEPVVKKKKKVESRPKKNQEAGKDEVTVEEHKRQKAGLKKNKKKKALKGKHSKKTTKS
IQGK
Download sequence
Identical sequences F7D1E6
ENSMODP00000025896 13616.ENSMODP00000025896 ENSMODP00000025896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]