SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025924 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025924
Domain Number 1 Region: 673-807
Classification Level Classification E-value
Superfamily EF-hand 0.0000000277
Family Calmodulin-like 0.043
Further Details:      
 
Domain Number 2 Region: 501-554,591-715
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000863
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000025924
Domain Number - Region: 204-214
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0288
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025924   Gene: ENSMODG00000020725   Transcript: ENSMODT00000026388
Sequence length 997
Comment pep:known_by_projection chromosome:BROADO5:5:53421431:53490136:-1 gene:ENSMODG00000020725 transcript:ENSMODT00000026388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNPSRVKPQLEAGAPRRAQPPRPGEPAAARARLSVPAASADGCGGLAAPGLPSPGGLRE
QRGLEIEMERIRQAAARDPPAGASASPSPPLSACSRQAWSRDNPGFEPEDEDEEDDDEEV
EGEEGGMVVEMDVECRPGSRRSAASSAVTSSCASGLGLGSFHGANIPSGRRRRRETQGAL
GCSSPAGPGEALHRHLPLDGPHQPQPPPPPLPPPRVPGAKRLLRALRGLWGTRLMEESST
SREKYLKSVLRELVTYFLFLVVLCILTYGMVSSSMYYYTRVMSQLFLETPVSKMEKTNFK
TLSTMEDFWKFTEGSLLDGLYWEMWYSNRTGAENRSFIYYENLLLGVPRIRQLKVRNGSC
SIPPDLREEIKECYDVYSISNEERAPFGLRHGTAWTYTNEKDLNGSSHWGLIATYSGAGY
YLDLSRTREETAVQIANLKKNIWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGV
ITSWQFQPVKLIHYISTFDFFLATCEITFCFFILYYIVEEILEIRIHKLHYFRSFWNCLD
IVIIALSIVAIGINIYRKSNVELLLKYLEDQNTFPNLEPLAYWQIQFNNVAAVMVFFVWI
KLFKFINFNRTMSQLSTTMSRCAKDLVGFAIMFLIIFLAYAQLAYLVFGTQVDDFSTFQE
CIFTQFRIILGDFNFTELEEANRVLGPIYFTTFVFFMLFILLNMFLAIINDTYSEVKSDM
AQQKTEMELSDLIRKGCQKAMIKLKLKKNTVDDISESLQQSGGKLNFDELRQDLKGKGHT
DAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDLDLDHSSLPRPMSIRSFPRNLDD
SEEDDDEDSGHSSRRRGSSSSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIME
RAKLKRREVLGRLLDGVTEDERLGRDNEIHREQMERLVREELERWESDDGASQISQRLGT
PVGLNGQPRPRGSRPSSSQSTEGIENGGGNGGASIHG
Download sequence
Identical sequences F7ANU1
ENSMODP00000025924 ENSMODP00000025924 XP_001370448.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]