SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026004 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026004
Domain Number 1 Region: 573-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000984
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 2 Region: 58-96
Classification Level Classification E-value
Superfamily SET domain 0.0000746
Family Histone lysine methyltransferases 0.042
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026004
Domain Number - Region: 109-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00752
Family Classic zinc finger, C2H2 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026004   Gene: ENSMODG00000020789   Transcript: ENSMODT00000026469
Sequence length 636
Comment pep:known_by_projection chromosome:BROADO5:5:58519261:58751264:-1 gene:ENSMODG00000020789 transcript:ENSMODT00000026469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CIISHFSSQKASIFLIISDSNSSSIDFIQVDTSAANGSSEGLMWLRLVQSARDKEEQNLE
AYIKNGQLFYRSLRRIAKDEELLVWYGKDLTDLLLLCSSRSHSKMNGSPPYTCLDCSQRF
QFEFPYVAHLRFRCPKRLHSADTSSHNEQDGGGCTKEHNGGGGGCGDRDQPQPEATLGPG
PKYCKPPAIPIHHYQTSQDSSNTSAPGAGSGIKPSTDFHNLARELENSRGGRSCSPPRSL
SSRGSSHQEVELRSGSVGGSGSKAKRKYPDELEEGSRGGVGLVGSRGRFAERPQPSSKED
LVCTPQQQYRTTGSYFGLEENGRLFAPPSPETGEAKRSAFVEVKKASRVVGATSAGEDKD
LGTAAGGVASNTSSPATSSSSSSPSGSEKLLGPRPGGPLSARLEGASPARGSAFTTVPQL
GSSGSAGGGGGSGASAGAVPGAVADERKSAFSQPARTFSQMPPLVLGQKLGSMEPCHPGD
GVGPTRLYPADPLAVKLQSAAADLNGACAPLQNGGGLPKQSPFLYATTFWPKSSAAAAAA
AAAAAGPLQLQLPSALTLLPPSFTSLCLPAQNWCAKCNASFRMTSDLVYHMRSHHKKEYA
MEPLVKRRREEKLKCPICNESFRERHHLSRHMTSHN
Download sequence
Identical sequences F6S864
ENSMODP00000026004 ENSMODP00000026004 13616.ENSMODP00000026004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]