SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026085 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000026085
Domain Number - Region: 85-95
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00194
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 164-380
Classification Level Classification E-value
Superfamily Porins 0.00476
Family Porin 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026085   Gene: ENSMODG00000020860   Transcript: ENSMODT00000026550
Sequence length 418
Comment pep:known_by_projection chromosome:BROADO5:4:370762538:370767417:1 gene:ENSMODG00000020860 transcript:ENSMODT00000026550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKGWGGTVRPMIKRPSRTNGGPRLHRGWGLRLRAWRRLPHGGSGTERKPGGAGALEVIM
GNVLAASSPPAGPPPPSGPGLVAAPPPPPLPPPPPGFTLPPIGGLSAGPGGRGGVPGGLA
GGAPAPEDEASCCLPNPGTFEECHRKCKELFPVQMEGVKLTVNKGLSNHFQVNHTVALST
IGDSNYHFGVTYVGTKQLSPTEAFPVLVGDMDNCGSLNAQVIHQLGPGLRSKMAVQTQQS
KFVNWQMDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGE
EGTVMSLAGKYTAPNWLATLTVGQAGAHATYYHKASDQLQVGVEFEASTRMQDTTVSFGY
QLDLPKANLLFKGSLDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
Download sequence
Identical sequences F6R080
ENSMODP00000026085 ENSMODP00000026085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]