SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026098 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026098
Domain Number 1 Region: 153-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 322-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 266-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 8-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-22
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 7 Region: 115-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.57e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 8 Region: 419-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-16
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026098   Gene: ENSMODG00000004295   Transcript: ENSMODT00000026563
Sequence length 477
Comment pep:novel chromosome:BROADO5:X:5272421:5285737:-1 gene:ENSMODG00000004295 transcript:ENSMODT00000026563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPFLTFRSQELVTFEDVAVYFTEEEWDRLHPAQRTLYRDVMLENYVNVTSLGDGIKME
NEEEPIPKPEMSEEDFPVPYEGAPPGGRAQRHDEYNHNFSLNPESVRQRIHSRVKRYECN
ECGNAFSKTSYLIVHQRFHSGEKPYKCNECGKAFSQTSNLIVHQRIHSGEKPYECNECGR
AFTARSGLKQHQRIHSGEKPYKCNECGKAFKETAHLIQHQRIHSGEKPYKCNDCGKAFSQ
ISSLIGHQRIHTGEKPYKCNECEKNFRCASHLIRHQRIHSGEEPYKCSDCGKAFNKISTF
ILHQRIHSGEKPYKCNECGKIFKGTTQLIQHQRIHSGEKPYECNECGKAFTQISNLIIHQ
GIHSGEKPYKCNECGKAFRLRSHFITHQRVHTGEKPYECNECGKAFSQTSNLIVHQRIHR
GEKPCKCNECGKAFRWSSELILHKRIHFGEKPYKYDEREKAFKQSSELISHEKIHTK
Download sequence
Identical sequences F6QG64
ENSMODP00000026098 ENSMODP00000026098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]