SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026203 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026203
Domain Number 1 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-28
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-26
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 128-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.45e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.99e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 450-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 90-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026203   Gene: ENSMODG00000029332   Transcript: ENSMODT00000026669
Sequence length 539
Comment pep:novel chromosome:BROADO5:Un:8329744:8331363:-1 gene:ENSMODG00000029332 transcript:ENSMODT00000026669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLLSDVPLDSKGGEARNQETPLDPHEAASKDGGQEHKERKSPIDPKSVLVPRGRGSVD
LWPPKPDPCRKGFKQNSNLMKPEGVCEVNKPWKCKECGKAFSYCSAFVLHQRVHTGEKPY
ACKECGKAFSQSIHLTLHQRIHTGEKPYECNECGKAFSQGSYLISHWKTHTGEKPYKCNE
CGKAFTRISHLTQHQRTHTGEKPYKCNECGKSFRNRSSLIEHQRIHTGEKPYECTECEKS
FRFSSALIRHQRIHTEEKPYKCSECGKAFTQISHLTQHQRIHTGEKPYKCNECGTTFSQS
SSLIEHQRIHTGEKPYKCNECGKAFTQISHLIQHQRIHTGEKPYKCNECGKAFSNRSHLI
QHHLIHTGEKPYKCVECGTTFSHGSSLIEHQKIHTGEKPYKCNECGKAFSQGSSLTLHQR
THTGEKPYRCNECGKAFSNRSYLIQHYIIHTGEKPYECSECGKAFSFSSALIRHQRTHTE
EKPYQCGDCGKAFGQILMLTQHQSVHSEEKLPVPSAGSKSISHGSTPDELQLFPSQEKM
Download sequence
Identical sequences H9H7U6
ENSMODP00000026203 XP_007505746.1.35504 XP_016282428.1.35504 ENSMODP00000026203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]