SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026214 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026214
Domain Number 1 Region: 665-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.15e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 723-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000236
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 337-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000403
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 4 Region: 762-814
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000127
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 5 Region: 503-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000679
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 422-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000108
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 7 Region: 592-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000463
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026214
Domain Number - Region: 48-163
Classification Level Classification E-value
Superfamily SET domain 0.00101
Family Histone lysine methyltransferases 0.049
Further Details:      
 
Domain Number - Region: 396-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0118
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 807-850
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0153
Family Classic zinc finger, C2H2 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026214   Gene: ENSMODG00000020959   Transcript: ENSMODT00000026681
Sequence length 1110
Comment pep:known_by_projection chromosome:BROADO5:4:1384131:1512450:1 gene:ENSMODG00000020959 transcript:ENSMODT00000026681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEGSDEAMFIWCEDCGQYHDSECPELGPVVMVKDSFVLSRARSSLPSNLEIKPLGDGT
EGVFAITQLVKRTQFGPFESRRVAKWEKESAFPLKVFQKDGHSVCFDTSNEDDCNWMMMV
RPAVDYEHQNLTAFQHDNDIYFTTSRDIPPGTELRVWYAAFYAKKMEKPVLKQVSNIVHE
HALGALEHVRGLPPGSHKEGSPEKEVEAPPKDAPAVCESGSGSREPKRKPRRGKKCRSAK
GEQPVIIAEEKEAAVDQVAEIITEIPPDEDLSATTEERIMELVLGKLPPSTTKDNSESKI
PKFAHHQSSLALKRSLILSGRHGIRRKLIKQLGEHKRVYQCNICSKIFQNSSNLSRHVRS
HGDKLFKCEECAKLFSRKESLKQHVSYKHSRNEIDSEYRYRCGTCEKSFRIESALEFHNC
RTDEKTFQCEMCFRFFSTNSNLSKHKKKHGDKKFACEVCNKMFYRKDVMLDHQRRHLEGV
RRVKREEFEASGETVVRYKKEPSGCPVCGKVFSCRSNMNKHLLIHGDKKYTCEICGRKFF
RVDVLRDHIHVHFKDIALMDDHQREEFIGKIGISSEENDNSDESADSEPHKYSCKRCQLT
FGRGKEYLKHIMEVHKEKGYGCSICNRRFALKATYHAHMVIHRENLPDPNVQKYIHPCEI
CGRIFNSIGNLERHKLIHTGVKSHACEQCGKSFARKDMLKEHMRVHDNIREYLCAECGKG
MKTKHALRHHMKLHKGIKEYECKECHRKFAQKVNMLKHYKRHTGIKDFMCELCGKTFSER
NTMETHKLIHTVGKQWTCSVCDKKYVTEYMLQKHIQLTHDKVEAQSCQLCGTKVSTRASM
SRHMRRKHPEVLSVRIDDLDHLPETTTIDASSIGIVQPELALEQGELPEGKHIKVAKRSH
KRKQKPDEEEDALVSEDPAFSDYTEKEAEFTGNVGDETNSAVQSIQQVVVTLGDPSVTAP
SSSVGLTNITVTPITTAAGTQFTNLQPVAVGHLTAPERQLQLDNSILTVTFDTVSGSAML
HNRPNDIQLHAQAEASNPQSVAHFINLTTLVNSITPLGSQLAEQPPLSWRAVPQADVLQP
PQPPQGAPPPPGQPQVQAAEPPQQQQMYSY
Download sequence
Identical sequences F6SNW9
ENSMODP00000026214 XP_007493124.1.35504 ENSMODP00000026214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]