SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026307 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026307
Domain Number 1 Region: 286-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-25
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.16e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 454-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 495-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 176-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000461
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026307   Gene: ENSMODG00000023116   Transcript: ENSMODT00000026775
Sequence length 552
Comment pep:novel chromosome:BROADO5:2:532113153:532123865:1 gene:ENSMODG00000023116 transcript:ENSMODT00000026775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFESYRLQAQEMVTLQDVAVDFTREEWRLLSPPQKELYREVMLENAQNLLSVGLPAPQE
DVLSYLEQREGPWILEQERLRIYCPAWTSEYEKTVVSSNAMTQDNSEGLLTKNATHIKRK
NCGSSNTEEKHMIDYLPEMKATPTEMSSFVEETDHQRLMSDVPNNIAWREFCVESQHSSH
TEHQKMNSEEKSGEWKQCGKIFRQRHKLAIHQKIHTEEKPYECKQCRKTFRLNSHLAIHQ
RVHTGEKPYECKQCGKTFCRSASLSYHQRIHTGEKPYECNQCGKYFSRSFHLARHQRIHT
GEKPFECKQCGKSFSRSSHLVKHERIHTGEKPYECKQCGKTFCQSSTLSSHQRIHTGEKP
YKCNQCGKTFSYSSGLAVHQSIHTGEHPYECKQCGKTYSRNSCLIIHQRIHTGEKPYECK
QCGKTFSHNSGLAYHQRIHTGEKPYECKECGKRFNHRSGLAYHQSTHTREKPYECKQCRK
TFRQSSKLVQHLRIHTEEKPYECNQCGKTFCHSSTLSSHQRIHTGEKPYECKQCGKTFIQ
SSKLVQHLRIHT
Download sequence
Identical sequences F6W0F0
ENSMODP00000026307 ENSMODP00000026307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]