SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026434 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026434
Domain Number 1 Region: 123-184
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000144
Family KRAB domain (Kruppel-associated box) 0.0043
Further Details:      
 
Domain Number 2 Region: 283-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000236
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 388-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000265
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026434   Gene: ENSMODG00000021148   Transcript: ENSMODT00000026905
Sequence length 487
Comment pep:known_by_projection chromosome:BROADO5:8:31035556:31050648:-1 gene:ENSMODG00000021148 transcript:ENSMODT00000026905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKEWGGGSGSSGKFAEGTKETQAVTVCVHGQEVLSEQSTTLGTLRESVNIPLERTEPQA
EEEGQEEGLQSPKLGPLEDSCSDSEEESQPIQERALPTPLVPVLPQEGSTRHWEMAAALP
GAGLQGLVTIKDVSLCFSQEEWRSLDPSQTDFYGEYIMEENCGIVVSLKFPIPKVDMISQ
LEGEEQWVPDPTQDLEERDIPRITYPGDRSEYDGNSPELEPGSHGTLSSMSEDAFLWSSE
REGAWETMPNNAMRKKRSPSAPRKNNFPNILCDIGADSLLSSHTCLQCGKHFVWGSSLAQ
HQQTHTSEKPYNCSRCDKSFGWRHHLARHLQTHIHENLSRFPVTGKKFQCISHLASPQKV
HVQGKKLPKAKKVEEVPQARKQSCIPSGLRCHVCSECGRSFGRRHHLVRHWLIHTGEKPF
HCPYCEKSFGQKHHLDRHLLTHQGSLRRTWNRVTSLLKPHSASTRASLSGSSQLLPGDLL
KGLSLPL
Download sequence
Identical sequences F6QCL1
ENSMODP00000026434 ENSMODP00000026434 XP_007502993.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]