SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026533 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026533
Domain Number 1 Region: 19-129
Classification Level Classification E-value
Superfamily POZ domain 3.14e-24
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1019-1071
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000173
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 1058-1114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000189
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 484-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000836
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 345-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000002
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000026533
Domain Number - Region: 459-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000315
Family Classic zinc finger, C2H2 0.056
Further Details:      
 
Domain Number - Region: 1133-1163
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00625
Family Classic zinc finger, C2H2 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026533   Gene: ENSMODG00000021228   Transcript: ENSMODT00000027008
Sequence length 1206
Comment pep:known_by_projection chromosome:BROADO5:7:218521046:218571100:-1 gene:ENSMODG00000021228 transcript:ENSMODT00000027008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPALELMTVMSHSKDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAA
SSLYFKNLFWSRTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETVTDLAAAGKK
LGISFLEDLTDSNFSNSPGPYVFCITEKGVVKEEKSEKRTEEPAIANGPRITNAFSIFET
ENNNSMFSPLDLRASFKKVSDSMRTSSFGLERNDVCSEAEPVRTLAEHSYAVPSAADAFQ
GRPLYECAASSPYTPSEENCDEVPANTQACRPKTPPRPQGSSLAVAKIAPPKGTSTETHG
EKSPDPAAACAPDSHKSQEDNHFSKEDENPPANIPESIAPVLPPVYNCTFCSKSFENGAL
LESHLLLHTKPPEAFMCKYCDKQFTTSNRLDKHEQTCMNSHRLPVPVGNEQSFSSPDGKM
ESSYKGSEMLSSENKAGEHAGTSQTLPEVEHTVKVVDGQILYTCIVCKRSYVTLSSLRRH
ANVHSWRRTYPCHYCSKVFALAEYRTRHEIWHTGERRYQCIFCLETFMTYYILKNHQKSF
HAIDHRLPVNKKTANGGLKPSIYPYKLYRLLPMKCKRAPYKSYRSSSYENPQENRQTGEA
APSTCIIPNPRSSELPILTFPDSVNMLSNSPAILPIVPASKEAHKVIDPQNGVPWGGGGG
GGEGGGGGGGLLSPVKNNFSPVEKPVPSGGKSLTSGSQGGDVTIPSYSNVSENATSVISY
SSSAPSVIVHSSRVSSVIMHSNAVTAMTSSSTIASNITVNQSPRDDSKHAESFGKIPTKV
RSIKEKKKMVPYNRGETLEEAKYAASSGGPLSKTTSVIEETSKTETYIAKPALPGTSTNS
NVAPLCQITVKIGNEAIVKRHILGSKLFYKRGRRSKHETQEESLPQENDVEQKESSSPTR
LSRSECVEMSEMFDEGSDQDSTDKPWRPYYNYKPKKKSKQLKKMKKVKWKKRHGNRSPSS
EFTNSSDLDCSIKKSPKEKIPEGEESKEMPSLHCELCVGDKGPTEGPPGQPHWHHNTSKS
HVCELCQKQFQSPSTLKMHMRCHTGEKPYACKTCGRCFSVQGNLQKHERIHLGVKEFICQ
YCSKAFTLNETLKIHERIHTGEKRYRCQFCLQSFLYLSTKRNHEQKHIHEHNGKGYACFQ
CPKICKTAAALGMHQKKHLFKSPNQPEKKEGGGNDIPKSFENQPFTDSGGNKMKETLQTM
PEEVFL
Download sequence
Identical sequences F6U0M6
ENSMODP00000026533 ENSMODP00000026533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]