SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026558 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000026558
Domain Number - Region: 25-113
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0201
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026558   Gene: ENSMODG00000021247   Transcript: ENSMODT00000027034
Sequence length 336
Comment pep:novel chromosome:BROADO5:7:212855272:212919738:1 gene:ENSMODG00000021247 transcript:ENSMODT00000027034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAPTGPTAPTDETKNSTNPKPEAPPSYASHYQPGPPAPGGYPATGYPAQGPGGYVGPNQ
PVGFPMYHQGGGQPIVYQPGVNVNPNQPPQISWMPGPPPLPNCPPGLEYLSQLDKIMVYQ
QVEALELMTRFESNNRYEVKNSMGQMIYMVLEDTDDVTRNAYKELRPFVLRVVDCMGREI
MRMQRPFRCTCCCFCCSCAMQELEVQAPPGVALGYITQHWGCCKANFSIENEKKEHVLDM
VGPCAPANCGSDTFYQIKSLDGSSIGSICRQWPGFLQVSVTDADNYDITFPLDLNITMKA
MVFAACFLIDFMFFERQPRSRRSTSHHHHHHHRRRH
Download sequence
Identical sequences F6TJB8
ENSMODP00000026558 XP_007502138.1.35504 XP_007502139.1.35504 XP_007502140.1.35504 XP_007502142.1.35504 XP_007502143.1.35504 XP_007502144.1.35504 XP_007502145.1.35504 XP_007502146.1.35504 ENSMODP00000026558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]