SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026563 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026563
Domain Number 1 Region: 284-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 331-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000202
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026563   Gene: ENSMODG00000021251   Transcript: ENSMODT00000027039
Sequence length 448
Comment pep:novel chromosome:BROADO5:7:211738093:211741609:-1 gene:ENSMODG00000021251 transcript:ENSMODT00000027039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRAKMLLDAGPQYPAIGVTTFGTSRHHSAGDVTDREVGLGINPFADGMGAFKINPSTHEL
ASAGQTAFTSQAPGYAAAAALGHHHHPTHVSSYSSAAFNSTRDFLFRNRGFGEAAASAQH
SLFASAAAGGFAGPHGHTDAAGHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYGRPDQ
YGQVTSPRSEHYGFPPSFHGYGHMNMNMAAPHGSGFFRYMRQPIKQELICRWIEPEQLSN
PKKSCNKTFTMHELVTHVTVEHGGPEQSNHICFWEECPREGKPFKAKYKLVNHIRVHTGE
KPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSD
KPYLCKMCDKSYTHPSSLRKHMKVHESSSQGSQPSPAASSGYESSTPPTIVSPSTENQTT
SSLSPSSSAVHHTSGHSTLSSNFNEWYV
Download sequence
Identical sequences F6TIU5
ENSMODP00000026563 ENSMODP00000026563 13616.ENSMODP00000026563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]