SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026636 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026636
Domain Number 1 Region: 65-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000462
Family HkH motif-containing C2H2 finger 0.037
Further Details:      
 
Domain Number 2 Region: 120-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000154
Family HkH motif-containing C2H2 finger 0.023
Further Details:      
 
Domain Number 3 Region: 233-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000357
Family HkH motif-containing C2H2 finger 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026636   Gene: ENSMODG00000021308   Transcript: ENSMODT00000027112
Sequence length 298
Comment pep:known_by_projection chromosome:BROADO5:7:202164967:202215221:-1 gene:ENSMODG00000021308 transcript:ENSMODT00000027112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILLQHTGLPSPEQLSPPPPMSVATRSRTTFLLSSQRPLGLEATLPLTRAQELTRAGAVE
PDFTLEELCRPLYCKLCNVTLNSAQQAQAHYQGKNHSKKLRNYYAASTCPASTRMSNIVE
PVPPPVVPAPPQVDVSKPGSRVIRATENDYCKLCDASFSSLAVAQAHYKGKNHAKRTRLV
EAQNNLSLDSSEVSQRRTRKEGNEYKMMQNRRNAYALQNNTGPYFNPRSRQWIPRDLAMC
VTPSGQFYCSMCNAGAGEEMEFRQHLESKQHKSKVSEQRVPFCKNETMILRLLMFTFV
Download sequence
Identical sequences F7G3H5
ENSMODP00000026636 ENSMODP00000026636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]