SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026655 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026655
Domain Number 1 Region: 181-326
Classification Level Classification E-value
Superfamily SET domain 3.4e-31
Family Viral histone H3 Lysine 27 Methyltransferase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026655   Gene: ENSMODG00000021327   Transcript: ENSMODT00000027133
Sequence length 902
Comment pep:known_by_projection chromosome:BROADO5:Un:7483611:7534720:1 gene:ENSMODG00000021327 transcript:ENSMODT00000027133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKWLGDSKNMVVNGRRNGGKLSNEHQPNQSKFQHAGKDALKAGRNAVERRSSRCSGTSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPWRSSRHFTKPDSCP
HTHSVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKTQERLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEYCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKTDATSNRKSSVGVKKSSKNRSLARPSSSSVSR
IPASSDTTSSKLTPIHNPRVPKKLKRPAIKPLLSKIKLRNQCKRPEQKGTSRKLQVGNLV
LKEPKVVLYKNLPIKKDKTAEGPASATAASGCLTRHAAREHRQGPVNGATEQDGGSAYIT
RRSVRTRTNWKETSEPALEPNLSGNSPSTWMGTGPGTDTDTVEPPVGHAVRDQEKAHEAT
SPKGEGRAPKDDISVAKKKSRQGKLLKQFAKAEEPISVLDAPEGDEVVPDLISSHSDHGE
SRDRVDGPASRQDCVPAATGGCSVGTPEHFKTKDNFRTAKSKKKRRITRYDAQLILENSS
GIPKLTLRRRHDSSSKAHDQDSDGMNASKISIKLSKDHDKDNSLYVAKLNNGFNSGSGGG
SATKLKIQLKREEESRGPYAEELRGDNGLCCQETLSLLESRMDMDDYSQYEEESAEESSS
SEEDDNDEDDEDDEDEDYEDEFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRL
NA
Download sequence
Identical sequences H9H7X1
ENSMODP00000026655 XP_001362478.1.35504 XP_007505713.1.35504 ENSMODP00000026655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]