SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026679 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026679
Domain Number 1 Region: 105-160
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000272
Family Variant RING domain 0.028
Further Details:      
 
Domain Number 2 Region: 77-87
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000022
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026679   Gene: ENSMODG00000021347   Transcript: ENSMODT00000027158
Sequence length 341
Comment pep:known_by_projection chromosome:BROADO5:Un:32023018:32093565:1 gene:ENSMODG00000021347 transcript:ENSMODT00000027158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKSRLRMFLNELKLLVLTGGGRPRPEPQPRGGGGAGCGWGPFAGCSARDSDGDDEEYYG
SEPRARGPGDKETRAGPPPPPPPPPPPAPGGLDSLSLSSSLDSGLRTPQCRICFQGPEQG
ELLSPCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVI
EKVQIAAIVLGSLFLVASISWLIWSSLSPSAKWQRQDLLFQICYGMYGFMDVVCIGLIVH
EGSSVYRIFKRWQAVNQQWKVLNYDKTKDLGGDAGGGMAGKPGCRTSLTGSPPGATGRPP
AAQRVRMLLPQHCGYTILHLLGQLRPPDARSSSRSGRSRLA
Download sequence
Identical sequences H9H7Y9
ENSMODP00000026679 ENSMODP00000026679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]