SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026813 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026813
Domain Number 1 Region: 13-126
Classification Level Classification E-value
Superfamily POZ domain 2.43e-26
Family BTB/POZ domain 0.00063
Further Details:      
 
Domain Number 2 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 354-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.13e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 277-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000143
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026813   Gene: ENSMODG00000021460   Transcript: ENSMODT00000027294
Sequence length 448
Comment pep:known_by_projection chromosome:BROADO5:3:271309352:271397126:-1 gene:ENSMODG00000021460 transcript:ENSMODT00000027294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTY
FKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFL
DKLCSQKRDVSSPEENNTQAKNKYCLKINRPIGESTDNQDDEVEEIGDQDDSPSDDTVEG
TPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMDTSESKDLGSQTPQGLT
FNDGISEVKDEQTPGWTTATSDMKFEYLLYGHREQIACQACGKTFSDEARLRKHEKLHTA
DRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPF
ACHMCDKAFKHKSHLKDHERRHRGEKPFVCSSCTKAFAKASDLKRHENNMHSERKQVPTS
AIQSETEQLQAAAMAAEAEQQLETIACS
Download sequence
Identical sequences F7GDU6
ENSMODP00000026813 XP_007487733.1.35504 ENSMODP00000026813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]