SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026885 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026885
Domain Number 1 Region: 134-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-27
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 697-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-26
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 529-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 50-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 8 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 9 Region: 176-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.83e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 10 Region: 641-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.91e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 11 Region: 743-795
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-22
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 12 Region: 491-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.14e-20
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 13 Region: 218-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 14 Region: 13-64
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000327
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 15 Region: 98-129
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000038
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 16 Region: 265-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000197
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026885   Gene: ENSMODG00000021519   Transcript: ENSMODT00000027367
Sequence length 797
Comment pep:novel chromosome:BROADO5:4:396676716:396698874:1 gene:ENSMODG00000021519 transcript:ENSMODT00000027367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITKHQQIQTGDNCYKYNECGKAFGQLSNLVDHKKIPSGEKPFKCNECERAFTCISRLNRH
QKIHTGEKPYKCNECGKTFIQSSNLIRHQMVHTGEKLFKCNKCGKSFTRNSRLIRHQKIH
IEEKPYICDECGKAFIQSSNLTRHQKIHTGEKPYKCNECGKIFTRKSRLIRHQKIHTGEK
PYKCNECGKTFIQSSNLIRHQVIHTGEKPYTCNECGKAFIQSSKLVRHKMVHTREKHHKW
NKCGKAFIQSSNRIMHQMIHMGETPYKCSEFEKAFSQCSSLTEHKKIPIGEKHFKCSECE
RAFTCISRLNRHQKIHTGEKPYKCNECGKTFNQSSNLIRHQMIHTGEKLYKCNDCGKAFT
RKSRLIRHQKNHTGEKPYKCDECGKTFIQSSNLIRHQMIHIGEKPYKCNECGKAFIRKSH
MILHQRTHIREKPHKCNDCGKAFIQSSDLDRHQRIHTGETPYKCSECGKPFFTNSQDSNF
SEHHKDHKVEKLYKCKECGKTFTRKSRIIRHQKIHTGEKPYKCDECGKAFMESSTLILHQ
RIHTKEKPYKCNECGKAFTQNSTLVMHQRIHTGEKPYKCNECGKAFSQSSNLIVHQKTHI
GEKPYKCNECGKSFTQNSTLVKHQRIHTGEKPYKCDECGKAFTQYSTLLKHHRIHNGEKP
YKCEECGKGFSESSTLIIHQIIHTGEKSYICHECGKSFIQSSNLIVHQKIHTGEKPYKCK
ECGKAFTQSSDLFKHHRIHTGEKPYKCDECGKAFIQSSLLIRHKMIHTGEKPYKCNECGK
AFSRSSNLVVHQKTHFG
Download sequence
Identical sequences F7FSE8
13616.ENSMODP00000026885 ENSMODP00000026885 ENSMODP00000026885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]