SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026952 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026952
Domain Number 1 Region: 155-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-26
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 99-156
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 211-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 43-100
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 6-57
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 267-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026952   Gene: ENSMODG00000005799   Transcript: ENSMODT00000028375
Sequence length 317
Comment pep:novel chromosome:BROADO5:Un:96974970:96975920:1 gene:ENSMODG00000005799 transcript:ENSMODT00000028375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSEKPTYECKQCGKAFSRLHNLAIHQRIHTGEKPYECKQCGKTFRYSSRLVQHQRIHTGE
KHYKCKQCGKAFSYSSHLVRHQRSHTGEKPYECKQCGKAFSSIHNLAIHQRIHTGEKPYE
CKQCGKAFSRLPSLAIHQRIHTGEKPYECKQCGKTFTQNSSLKAHQRIHTGERPYECKQC
GKTFSRIPSLAIHQRIHTGERPYECKQCGKTFINRPGLIVHQRIHTGEKPYECKQCGKTF
INSSGLTVHERIHTGEKPYECKQCGKTFINSSGLTVHERIHTGEEPYECKQCGKTFKSSS
ALARHQRTHTGEKFYEC
Download sequence
Identical sequences H9H831
ENSMODP00000026952 13616.ENSMODP00000026952 ENSMODP00000026952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]