SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026961 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026961
Domain Number 1 Region: 96-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.45e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 152-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.28e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 376-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 41-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.62e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 8 Region: 2-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-16
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026961   Gene: ENSMODG00000022548   Transcript: ENSMODT00000028400
Sequence length 427
Comment pep:novel chromosome:BROADO5:Un:90323743:90325023:1 gene:ENSMODG00000022548 transcript:ENSMODT00000028400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKFYKYPQCRKAFNKSSKLILHQRIHVGENPYECNVCGKGFHHRSKLNIHQRAHTRKNPY
QCNDCGKMFINDSKLILHQRIHIGEKPFKCNDCGKVFSHRSKFIIHQRIHTGEKPFKCHD
CGKAFNQNSHLLQHQRIHTGEKPFKCDDCGKAFNQNSNLHQHQRIHTGEKPFKCNDCGKA
FIQISHLLQHQRIHTGENPFLCHDCGKAFNQNSNLHQHQRIHTGEKPFKCNDCEKAFNRS
STLLKHQRIHTGEKPFQCHDCGKAFNQNSHLLQYQRIHTGEKPFQCHDCGKAFNQNSHLL
QHQRIHTGEKPFQCHDCGKAFNQSSHLFQHQRIHTNERPFKCNDCGKAFNQSFHLLQHQR
IHTAEKPFQCHDCGKVFSHRSKLIIHQRIHTGEKPFKCHDCGKAFNRISNLLKHQRIHTS
EKPFKCN
Download sequence
Identical sequences H9H840
13616.ENSMODP00000026961 ENSMODP00000026961 ENSMODP00000026961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]