SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026999 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026999
Domain Number 1 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.72e-27
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 622-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 678-735
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 147-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.74e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 91-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 482-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 7 Region: 566-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 35-92
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 9 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 10 Region: 734-790
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.96e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 11 Region: 789-846
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.47e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 12 Region: 845-899
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-20
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 13 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 14 Region: 210-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-18
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 15 Region: 1-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.88e-18
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 16 Region: 317-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-17
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 17 Region: 889-935
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000854
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 18 Region: 529-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000274
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026999   Gene: ENSMODG00000012936   Transcript: ENSMODT00000028460
Sequence length 935
Comment pep:novel chromosome:BROADO5:Un:73688941:73695958:1 gene:ENSMODG00000012936 transcript:ENSMODT00000028460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKQCGKAFKHRSDLVKHQRIHTGEKPYACKQCGKAFTRRSILASHERIHTEEKPYACEQC
GKAFTERGHLAAHERIHAGEKPYACKQCGKAFTKRMDLGIHERIHTGEKPFACKQCGKAF
TQRSILTVHQRIHTGKKPYACKQCGKAFSQSYYLAAHQIIHSGEKPYECKQCGKSFTWRD
SLVVHERIHTGEKSYVCKQCGKAFSERANLVHEKIHSGEKPYVCKCGKAFTEKGHLVVHQ
RIHTGEKPYPCNQCGKAFTHSSSLVTHQRVHTGEKPYQCKHCGKAFTQSCHLVRHQSIHM
GEILYDYKQCGTAFTHQNSELSSHQIIYSGEKRYACKQCVQSFQWRCDLVKHQRIHTGEK
PYACKQCGKAFIQRSDLLKHQRIHTGEKPYACEQCGKAFTQRSNLAKHQRIHTGEKPYAC
KQCGKAFTERSILASHQRIHTGEKPYACKQCGKAFTGRCVLVKHERIHTGEKRYACKQCG
KAFTESGHLAAHQRIHTGEKPYECKHCGKTFTQSGHLATHQSIHMGEKPYECKQCGKAFT
ERGHLAAHERIHSGEKPYACKHCGKAFTRRMDLVIHGRIHTGEKPYECKQCGKAFTQRGN
LAMHQRNHNGEKLYECKQCGKAFTQRSILASHQRIHTGEKPYACKQCGKAFTQRNHLAAH
QRIHTGEKPYACKQCGKAFSQSYYLAAHQIIHSGEKPYECKQCGKSFTWRDSLVVHERIH
TGEKPYACKQCGKAFSEKANLVVHERIHSGEKPYVCKCGKAFTEKGHLVVHQRIHTGEKP
YPCKQCGKAFTHSSSLVTHQRVHTGEKPYQCKHCGKAFTQSGHLARHQNIHMGEKVYECK
QSGRAFTQSDHLAAHQRIHTGEKPYACKECGKGFTERGLLVAHERIHTGEQSFECKQCDL
ALHQSIHTGENRYKCNQCGKAFRISSDLCKHQRIH
Download sequence
Identical sequences H9H878
ENSMODP00000026999 ENSMODP00000026999 13616.ENSMODP00000026999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]