SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027009 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027009
Domain Number 1 Region: 300-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000827
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027009   Gene: ENSMODG00000022616   Transcript: ENSMODT00000028479
Sequence length 376
Comment pep:known_by_projection chromosome:BROADO5:Un:69521257:69522387:1 gene:ENSMODG00000022616 transcript:ENSMODT00000028479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDHLLPVGESFSTTKFPLGYLGDMPAGGRAYHMLPSPLSEDDSDSSSFCSCSSPDSQVL
GSGYGSTPSVEGQGSILDYLLSQATLGGSPVAWWDWRRCQPMVKEEHFRFPEPEDMGPFQ
PTLEEIEEFLEENMELELKEGPEDGTKDLRVCSQLSSGQHKDHILPGGSLKESKTPQSGS
STEGAHSSNSTAATEGGIPVILQIQPMQIKQESSTGPSSPGQNPDNIKIAQLLVNIQGQT
FALVPQIVQSSNLNLPSKFVRIAPVPIAAKPIGPGGMVPGPAGILVGQKFPKNPAAELIK
MHKCTFPGCTKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRSVSWGGVCVPLLMVWGAS
YSNPLRVQQTRAFDEK
Download sequence
Identical sequences H9H888
ENSMODP00000027009 XP_007505542.1.35504 ENSMODP00000027009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]