SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027020 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027020
Domain Number 1 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.63e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 156-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 492-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-26
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 100-157
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.2e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 6 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-23
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 8 Region: 45-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 9 Region: 2-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-16
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 10 Region: 203-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000407
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027020   Gene: ENSMODG00000022640   Transcript: ENSMODT00000028504
Sequence length 557
Comment pep:novel chromosome:BROADO5:Un:66294276:66295946:1 gene:ENSMODG00000022640 transcript:ENSMODT00000028504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTGEKFYKCPQCRKAFNKSSKLILHQRIHVGENTYECNVCGKGFHHRSKLSIHQRAHTR
KNPYQCNDCGKMFINDSKLILHQRIHTGEKPFKCNDCGKVFSHRSKLIIHQRIHTGEKPF
KCDDCGKAFNQSSHLLQHQRIHTGEKPFKCHDCGKAFNQSSNLLQHQRIHTGEKPFQCSD
CGKAFNRSSHLFQHQRIHTGEKPFKCDDCGKAFHQNSHLLQHQRIHTGEKPFLCHDCGKA
FNWISNLLQHQRIHTGEKPFKCSDCGKAFSQSSHLLQHQRIHTGEKPFQCHDCGKAFNQN
SNLSVHQRIHTSEKPFQCHDCGKAFKQISHLFHHQRIHTGEKPFKCNDCEKAFNRSSNLL
KHQRIHTGEKPFKCDDCGKAFIRSSTLLQHQRIHTGEKPFKCDDCGKAFIQSSTLLQHQR
IHTGEKPFKCNDCGKAFNQNSHLLHHQRIHTGEKPFQCHDCGKAFNRNSHLLQHHRIHTG
EKPFHFHDCEKAFNQSSHLLQHQRIHTGEKPFKCHDCGKAFNQSSHLLQHQRIHTGEKPF
KCNDCGKAFNQSSNLIV
Download sequence
Identical sequences H9H899
ENSMODP00000027020 13616.ENSMODP00000027020 ENSMODP00000027020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]