SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027030 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027030
Domain Number 1 Region: 154-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 210-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 546-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 98-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.1e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 378-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 661-716
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.21e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 490-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.02e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 9 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 10 Region: 590-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.49e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 11 Region: 43-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 12 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-19
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 13 Region: 1-52
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000792
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027030   Gene: ENSMODG00000022652   Transcript: ENSMODT00000028518
Sequence length 717
Comment pep:novel chromosome:BROADO5:Un:63072844:63075066:-1 gene:ENSMODG00000022652 transcript:ENSMODT00000028518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGEKFYKCPQCRKAFNKSSKLILHQRIHVGENLCECNDCGKGFHHRSKLNIHRRAHTRKN
PYQCNDCGKMFINDSKLILHQRIHTGEKPFKCNDCGKVFSHRSKLIIHQRIHTGEKPFKC
HDCGKAFIRSSHLLQHQRIHTDEKPFKCDDCGKAFKQNSHLLQHQRIHTGEKPFKCDDCG
KAFNQNSNLSVHQRIHTSERPFQCNDCGKAFNRSSHLLQHQRIHTGEKPFKCDDCGKAFN
QSSHLFKHQRIHTGEKPFQCHDCGKAFNQSSHLLQHQRIHTGEKPFQCHGTGKDFNQNSN
ISVHQRIHNTERPFQFHDCGKSFKQSSHLLQQQRIHTGEKPFQCHDCGKAFNQSSHLLQH
QRIHTGEKPFQCNDCEKAFNQSSTLLKHQRIHTGEKAFKCDDCGKAFNQNSHLLQHQRIH
NGEKPFKCNDCEKAFNRSSTLLKHQRIHTGEKPFKCNDCGKAFNQNSHLLQHQRIHTGEK
PFQCHDCGKAFNRSSTLLKHQRIHTGEKPFQCHDCGKAFNQSSHLLQHQRIHTDEKPFQC
SDCGMAFNQSSTLLKHQRIHTDEKPFKCNDCGKAFNQSSHLLQHQRIHTGEKPFKCGVCG
MAFNQSSPLLQHQRIHTGEKPFKCNDCEKAFNRSSDLLKHQRIHTDEKPFKSIKCHDCGK
AFNQNFYLLRHQRIHTGEKPFKCNDCEKAFNRSSTLLKHQRIHTGEKPFKCNDCGKA
Download sequence
Identical sequences H9H8A9
ENSMODP00000027030 13616.ENSMODP00000027030 ENSMODP00000027030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]