SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027167 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027167
Domain Number 1 Region: 80-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000155
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 2 Region: 118-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000683
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027167   Gene: ENSMODG00000022734   Transcript: ENSMODT00000028692
Sequence length 162
Comment pep:known_by_projection chromosome:BROADO5:Un:44140398:44140886:-1 gene:ENSMODG00000022734 transcript:ENSMODT00000028692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGRSPQDPSSSLEKAMDAPPSKAASFPKPDPSAASMSPSPRLGRYLLIDANGVPYIYTVL
VEEEPPRVGPKGEAGPAPRKGYSCPECGRLFESPCRLQSHRISHSDLKPFVCGACGKAFK
RSSHLSRHRSMHQPEGSRCHACPLCPRRFRDAGDLAQHFRGH
Download sequence
Identical sequences H9H8N8
ENSMODP00000027167 13616.ENSMODP00000027167 ENSMODP00000027167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]