SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027169 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027169
Domain Number 1 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.01e-27
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 832-889
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 100-157
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-25
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 7 Region: 156-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.11e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 8 Region: 776-833
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 9 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 10 Region: 692-749
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 11 Region: 525-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 12 Region: 888-945
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 13 Region: 45-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.36e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 14 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-20
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 15 Region: 930-982
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 16 Region: 636-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 17 Region: 2-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000674
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 18 Region: 739-771
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000391
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 19 Region: 203-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000597
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027169   Gene: ENSMODG00000022735   Transcript: ENSMODT00000028694
Sequence length 1009
Comment pep:novel chromosome:BROADO5:Un:43545084:43610158:1 gene:ENSMODG00000022735 transcript:ENSMODT00000028694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTGEKFYKCPQCRKAFNKSSKLILHQRIHVGENLCECNDCGKGFHHRSKLNIHQRAHTR
KNPYQCNDCGKMFINDSKLILHQRIHTGEKPFKCNDCGKVFSHRSKLIIHQRIHTGEKPF
KCDDCGKAFNQSSHLVQHQRIHTGEKPFQCHDCGKAFNQSSHLLQHQRIHTGEKPFQCHD
CGKAFNQNSNLSVHQRIHTSERPFKCNDCGKAFNQSWHLLQHQRIHTGEKPFKCHDCGKA
FIRSSNLLQHQSIHTGEKPFKCDNCGKAFNQNSNLLQHQRIHTGEKPFKCDDCGKAFNQN
SHLLKHQTIHTGEKPFQCHDCGKAFNQNSHLLRHQRIHTGEKPFKCNDCDKAFSQRSKLN
IHQRIHTGEKPFKCNDCDKAFSQRSKLNIHQRIHTDEKPFKCDNCGKAFNQNSNLLQHQR
IHTGEKPFKCDNCGKAFNQNSNLLQHQRIHTGEKPFKCNDCGKAFNQTFNKSSKLILHQR
IHVGENPYECNDCGKGFRHRSKLNIHRRAHTRKNPYQCNDCGKMFINDSKLILHQRIHIG
EKPFKCNDCGKVFSHRSKLIIHQRIHTGEKPFKCDDCGKAFNQNSNLSVHQRIHTSERPF
QCNDCGKAFNRSSHLLQHQRIHTGEKPFKCDDCGKAFNQSSHLLQHQRIHTGEKPFQCHG
TGKAFNPNSNISIHQRIHNIERLFKCNDCGKAFKQSSHLLQHQRIHTGEKPFQCHDCGKA
FNQNFNLSVHQRIHTGEKPFQCHDCGKAFNQNSHLHRHQRIHTGEKPFKCNDCEKAFNRS
SHLLQHQRIHTGEKPFKCHDCEKAFNRSSHLLQHQRIHTGEKPFKCDDCEKAFNRSSHLL
QHQRIHTGEKPFKCNDCEKAFNQSSHLLQHQRIHTGEKPFKCDDCGKAFNQNSHLLQHQS
IHTGEKPFKCNDCEKAFNGSSTLLKHQRIHTGEKPFQCHDCGKAFNQNSHLLQHQRIHTG
EKPFQCHDCGKAFNQSSNLLQHQRIHTDFNKRTNFLVNQRIHIGEEPYK
Download sequence
Identical sequences H9H8P0
13616.ENSMODP00000027169 ENSMODP00000027169 ENSMODP00000027169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]