SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027244 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027244
Domain Number 1 Region: 40-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.17e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 405-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-25
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 4 Region: 152-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-23
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 8 Region: 2-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 502-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 97-153
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 11 Region: 367-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000168
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027244   Gene: ENSMODG00000000288   Transcript: ENSMODT00000028785
Sequence length 553
Comment pep:novel chromosome:BROADO5:Un:32744484:32746142:1 gene:ENSMODG00000000288 transcript:ENSMODT00000028785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKVYKCDECGKTFGRKSCFIRHQRIHSGERPYECKECGKAFNQNSTLAKHQRIHTGEKPF
ECHECGKAFRTSSSLTRHRRVHTGEKPYECNECGKMFRGRANLIHHQRTHSEGKPCESRE
CGKSFMGSSGLSKHQRIQSGEKPHECKQCGKVFKWSSSISKHQRIHSGEKPYECKECGKA
FIQSSDLSKHQRIHSGEKPYECKQCGKAFIQSSDLSNHQRIHSGEKPYECKECGKTFRGR
SGFSKHLRIHSGEKPHECKECGKAFIQNSDLNKHQRIHSGEKPYECKECGKAFTFRSGLS
KHQRIHSGEKPYECKECGKAFTFRSGLSQHQRIHSGEKPYECKECGKTFRGSSGFSKHLR
IHTGEKPYECNECGKAFTFRSGLSKHQRIHSGEKPYECKQCGKGFTFRSGLSRHQRIHSG
EKPYECNECGKAFIQSSDLIKHQRIHSGEKPHECKECGKAFIQSSDLSNHQRIHSGEKPY
KCKDCERAFRVRSSLIGHQRIHSGEKPYKCKDCERAFRVRSSLIGHQRIHSGAKPYVCEN
CGKAFRWHSSLND
Download sequence
Identical sequences H9H8W4
ENSMODP00000027244 13616.ENSMODP00000027244 ENSMODP00000027244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]