SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027305 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027305
Domain Number 1 Region: 496-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-27
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 104-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 5 Region: 272-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 329-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 216-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 8 Region: 160-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-22
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 9 Region: 543-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 10 Region: 51-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000254
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027305   Gene: ENSMODG00000022794   Transcript: ENSMODT00000028847
Sequence length 599
Comment pep:novel chromosome:BROADO5:Un:24912628:24930200:1 gene:ENSMODG00000022794 transcript:ENSMODT00000028847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSAAEREIRPEMKLTATEVSLSVEEMNLQRFMSDCPDNFAFREFCVAPQNSSHIEHQG
IHSGDKSSEDNQCGKTLMHRAIRVGHQRRQSLKKPYECKQCGKTFTYYSSLARHQRIHSG
EKPYECNQCGKTVSRSSYLAQHQRIHSGEKPYECNQCGKTFSQSCNLFIHQRIHSGVKPY
ECNQCGRAFRLSSSLAVHQRIHSQEKLYECKQCGKTFHWNSSLAKHQRIHTGEKPCECKQ
CGKTFHWNSSLAKHQRIHTGEKSYECKQCGKTFHWNSSLAKHQRIHTGEKPYECKQCGKT
FNQSYHLAIHQRIHTGEKPFECKQCGKRFSENSILAVHQRIHTGEKPYDCKKCGKTFSQS
CNLALHQRIHTGEKPYECNQCGKTFSRSSSLAVHQKIHSGEKPYECNQCGKTFSRSSHLA
VHQRIHTGETPYECNQCGKTFSQSSSLAVHQRIHTGEKPYECKKCGKTFSQSCHLALHQR
IHSGEKPYECNQCGKTFSRSSHLAVHQRIHTGEKPYECNQCGKTFSRSSSLAVHQRIHTG
ETPYECNQCGKTFSQSSSLAVHQRIHTGEKPYECKKCGKTFSQSSYLAVHQRIHTREKP
Download sequence
Identical sequences H9H925
ENSMODP00000027305 ENSMODP00000027305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]