SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027341 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027341
Domain Number 1 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 484-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.42e-22
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 5 Region: 203-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 581-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 2-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-18
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 10 Region: 149-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027341   Gene: ENSMODG00000022805   Transcript: ENSMODT00000028882
Sequence length 640
Comment pep:novel chromosome:BROADO5:Un:20939342:21099727:1 gene:ENSMODG00000022805 transcript:ENSMODT00000028882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVVTFQDVAVNFTREEWRLLSPPQKELYREVMLENARNLLSVGKEPLPAASVCHPRECRP
QQQAGWGAVFSQEEGTRAVIHTRKALSKFSSSLFLYFSLFRKEFTTLSSPRADPSRLEIK
AIPTEESLSVKERDQQRFMRGGPYNCVVSQNSSLIEYQRMHTEQNSSECKQCGKTFMHKA
SLAGHQRIHSGEKSYECKHCGKAFRGNSELALHQRIHPGEKPCEYKQCRRTFSGSASLAQ
HQRIHTGEKPFECKQCGKTFRQISSLVRHHRIHSAEKFYEGKQCGKTFSRSSYLADHQKI
HTGEKPFECKECKRTFSQSSKLAQHQRIHTVEKSNECKQCGKTFSGSYYLADHQRIHTGE
KPYECKQCGKTFRQASNLVVHLRIHTGEKPFQCKQCGKTFRENSKLTLHWRIHTGEKPFE
CNRCGKTFRQSSSLARHQRIHTGEKPFECKQCGKTFRQSSSLARHQRIHSGEKPYECKQC
RKKFSRSCYLADHQRIHTGEKPYECRQCGKTFWESSCLARHQRIHTGEKPYECKQCGKTF
RDNSCLSRHQKIHIQIIPAECKQCGKIFSLRSSLAQHQRIHTGEKPYECKQRGKTFRLRS
SLARHQRIHTGEKLYECKQCGKSFSQSSHLTGHQRNHRLS
Download sequence
Identical sequences H9H961
ENSMODP00000027341 ENSMODP00000027341 13616.ENSMODP00000027341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]