SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027416 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027416
Domain Number 1 Region: 133-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.42e-16
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 430-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000139
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027416   Gene: ENSMODG00000001780   Transcript: ENSMODT00000028957
Sequence length 487
Comment pep:known_by_projection chromosome:BROADO5:Un:12214895:12243582:1 gene:ENSMODG00000001780 transcript:ENSMODT00000028957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGRLALIGRKLKQSLFKMDIENCNGRSYMSGSGDSSLEKDFSGAPVGPSVSTPNSQH
SSPICSLSGNSIKVEMYSDEESSRLLGPDDRLLEKEDSVIVEDSLSEPLGYCDGSGPEPH
SPGGIRLPNGKLKPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCNYACRRRDALTG
HLRTHSGPPSDDMRDLEMVPDSMLLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMR
FSLSDLPFDMNSGGYEKDVELVAHPSLDPGFGSLAFVGTEHLRPLRLPPANCISELTPVI
SSVYTQMQPLPGRLELPGTREAGEGHEDLVDGGPLLYRARGPLADPGVSPSNGCQDSTDT
ESNHEERGGGIVTTPQCPPNQPASALVVGSRPSPAYAKEDPKMQEGLPRSAPGSAKDMLR
VVGEDGEPVKAFKCEHCRILFLDHVMFTIHMGCHGFRDPFECNICGYHSQDRYEFSSHIV
RGEHKVG
Download sequence
Identical sequences H9H9D6
ENSMODP00000027416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]