SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027441 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027441
Domain Number 1 Region: 572-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 740-797
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 684-741
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.78e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 628-685
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.06e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 784-844
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 7 Region: 516-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 8 Region: 405-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 9 Region: 195-255
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-22
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 10 Region: 349-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000314
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 11 Region: 307-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000158
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 268-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000129
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027441   Gene: ENSMODG00000022827   Transcript: ENSMODT00000028982
Sequence length 845
Comment pep:novel chromosome:BROADO5:Un:9690577:9708734:1 gene:ENSMODG00000022827 transcript:ENSMODT00000028982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTERLKGRHWESPSPKHAITRFAPPLLPRYACAAASAHTPRLVNRELVCLGLPGPNSRKS
RLPEQGARAERGPLTPSPPPLTQQRSKTHRSKPSGSRAWPGEIPCVPGGCCRGRSQEEGE
DRKQKLHFEKNNRIALFPLKTRIQKISFPVLRKGEALPAGPQPASMPAASLLPRKRRQRA
CRGPRGVAPGSPGPPAQVLVTFQDVAVDFTQEEWRLLDLGQKELYKEVMLENVQNMLFLG
LPVPREDWISHFDQGRAPWMLEGEGPSNSRLGEHQRSHAGEMLYTHNAVEEALSHNSELT
DHQKIQNGEKHYECNDCGKAFKKQLSLIHHQKFHTSTKLHKCMQCGQGFWKHSSLISHQN
IHTRQSSNEYPQRIKTFSEKSHLVIHQRIHSGEKSYECNQCGKFFKQKYCLANHQRIHTG
EKLYICSQCGKSFSQKGNLNTHQRTHTGEKPFECHQCGRTFRLNSHLSAHQRIHTGEKPY
KCNQCGNRFRQKVNLVVHQRTHTGEKPFKCHQCGRSFRLNSHLSAHQRIHTGEKPYKCFH
CGKSFRQSCTLTDHQRIHTGEKSFECNQCGKSFSRSSCLVSHQRIHTGEKPYECNQCGKN
FKQKSGLAQHKRIHSGEKPYKCSQCGKSFKQKSCLAKHQKIHTGEKPYKCNQCGKSFSRS
FCLASHQRMHTGEKPYECKECGKTFRQRGNLNAHQRTHTGEKPYECHQCGRSFRLNCSLT
AHQRIHTGEKPYKCNQCGKSFRQSSTLTDHQRIHTGEKSYECNQCGMAFRKSSRLAQHQR
IHTGEKPFVCNQCGKTFRRNSELSQHQRIHTGEKPYDCNQCGKSFRQRSNLAEHQRTHTG
EKPYE
Download sequence
Identical sequences H9H9G1
ENSMODP00000027441 ENSMODP00000027441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]