SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027444 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027444
Domain Number 1 Region: 348-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 460-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.3e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 180-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.23e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 1-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 8 Region: 505-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.58e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 71-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000542
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 127-184
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000037
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027444   Gene: ENSMODG00000022828   Transcript: ENSMODT00000028985
Sequence length 562
Comment pep:novel chromosome:BROADO5:Un:9636772:9644041:1 gene:ENSMODG00000022828 transcript:ENSMODT00000028985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVTFRDVAVDFTQEEWRLLDPGQKELYKEVMQENAQNMLSLGWSSYSNHSPKWECNENAE
MLYTHNAVEEAFSHNSELTDHHKIQNGKKHYECNDCGKAFKKQLSLIHHQKFHTSMKLHK
CMQCGQAFRRQSLLLSHQKIHTRKTSNEYPEHSKTFSEKSSLIVYERSHTEEQSYECNHF
SRSFCLASHQRMHTGEKPYECKQCGKTFRQRGSLNTHQTTHTGEKPYACHQCGRSFRLNS
HLSAHQRIHTGEKPYKCNQCGKSFRQSSTLTDHQRIHTGEKSYECNQCGMAFRKSSRLAQ
HQRIHSGEKPFVCNQCGKTFRCNSGLAQHKRIHTGEQPYACKQCGKRFRQRGNLVVHERT
HTGEKPYECNQCGKTFPRPDRLAQHQRIHTGEKPYKCNQCGKTFRQYFSFAEHKKIHTGE
KPYACNQCGKAFRCNSDLRKHHRIHTGEKPFVCKQCGKRFIQSSSLTVHQKIHTGVKPYE
CDDCGKAFSNHSALLIHQRIHTGEKPYECDHCGKPFRDRSSLVVHQRIHTGENPYECFQC
QKTFKVRSQLAIHQRIHSGEKP
Download sequence
Identical sequences H9H9G4
13616.ENSMODP00000027444 ENSMODP00000027444 ENSMODP00000027444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]