SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027452 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027452
Domain Number 1 Region: 197-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.95e-26
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 369-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.92e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 309-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.26e-24
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 4 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 407-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 144-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 57-107
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.23e-18
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027452   Gene: ENSMODG00000022832   Transcript: ENSMODT00000028993
Sequence length 468
Comment pep:novel chromosome:BROADO5:Un:9292150:9311472:-1 gene:ENSMODG00000022832 transcript:ENSMODT00000028993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGIFPGTQFSPLPPPPGPQRGSFPTPWDSHHLKDPSLAPAKSLEPEGMAHGTPRPPSQG
SITLKDVTVDFTQEEWSLLDHSQKELYLEVMLENMQNLLSVEQTIWKVTRDSQNTAEKFS
QYSVLNHYTKLTSGNECCRKPSSHNCELVVHQVNHCGKKPYECKQCGKTFIQKGHLARHQ
RIHTGEKPYECKYCGKAFTQKCNLARHQRIHTGEKPYECKQCGKAFADRSNLEAHKRIHT
GEKPYKCKQCGKAFTERSALAKHQRIHTGEKPYECKQCRKTFTRSLGLARHKTVHSGEKP
YECKQCGKTFTRKSTLSVHQRNHTGEKPYECKQCGKAFTNRYHLATHQRMHTGDKPYECK
QCGKALNGKGNLVAHQRIHTGEKPYECKQCGKAFTERGHLTVHQRIHTGEKPYKCKHCGK
TFMRKGDLVAHQRIHTGEKPYKCKLCGKAFTQRSNLDTHKKIHPGEKP
Download sequence
Identical sequences H9H9H2
ENSMODP00000027452 ENSMODP00000027452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]