SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027478 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027478
Domain Number 1 Region: 438-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 326-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.34e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 382-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-24
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 270-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-24
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 214-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.85e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 7 Region: 484-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 158-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-19
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 9 Region: 111-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000039
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027478   Gene: ENSMODG00000028761   Transcript: ENSMODT00000029019
Sequence length 541
Comment pep:novel chromosome:BROADO5:Un:8247034:8257236:-1 gene:ENSMODG00000028761 transcript:ENSMODT00000029019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGSPSPPAQESLTFQDVAVDFTQEEWRLLEPPQKELYREVMLDNAQNLLFLGIPVPRG
YLISHFKQEGPRNSCLDAETRVDVKELPTEVKMTSWKEYFHSNESRADCSKLERIHSGEK
HYEGNQHGKALRKGSSVAKNKRIHTEEKPHEGHECGKAFRDPSSHIVHHRIHPRGKPHEC
NHCGKAFRSRDRCIHHQRIHTGERPYACNECGKSFTYNCSLAVHLRSHTGEKPYKCKQCG
KTFTSSSSLTYHQRVHTGAKPYECNQCGKTFTSSSHLTYHRRTHTGERPYECNQCGKAFR
SSSNLAVHQKNHSGEKPYHCNQCGKAFKRSYNLTYHQRIHTGEKPYECTHCGKTFSSSSS
FTYHQRIHTGERPYECNQCGKTFTCSSHLTSHQRMHTGERPYECNQCGKTFRSSSRLTDH
QRMHTGERPYKCNQCGKTFTSSSSLNYHRRMHTGERPYECNQCGKTFTSSSSLNYHQRMH
TGERPYECNQCGKTFTSSSHLTYHQRMHTGERPYECHQCGKAFRSNSHLTYHQRNHTGEK
P
Download sequence
Identical sequences H9H9J8
XP_007505740.1.35504 XP_007505741.1.35504 XP_007505742.1.35504 ENSMODP00000027478 ENSMODP00000027478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]