SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027483 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027483
Domain Number 1 Region: 217-274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 413-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 273-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 469-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.47e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 165-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 511-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-20
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 8 Region: 320-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000265
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 1-39
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000000000325
Family SCAN domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027483   Gene: ENSMODG00000022837   Transcript: ENSMODT00000029024
Sequence length 578
Comment pep:known_by_projection chromosome:BROADO5:Un:8188660:8191931:-1 gene:ENSMODG00000022837 transcript:ENSMODT00000029024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLELLVLEQFLRVLPAGLRARVRARRPGSGEEAVRLLEGPPRGGGAQLSPEEDPQPPNTG
VHDDLWARPAGHLGGGPSGPSSEVLAGLEGGEGPGARSTDCERTDKDQKWAPWQQRSEEG
EPPEGRSEAAPSPEHAGAWDCQGGPERLPKAPSLEGGVGVSVPHACELTRHQRGHVGDKP
CTCPECGKAFSQSSYLLQHQRVHTGEKPYRCRECGKAFAWSSNLIQHQRIHTGEKPYACP
ECGKAFRAHSQLIHHQKIHSGEKPYQCRECGKAFGRSTTLIQHQRIHTGEKPYQCQECGK
AFNWNSNFIEHQRIHTGERPHACGQCGKAFSQSSNLIEHLKIHTGEKPHACGQCGKAFMR
SSGLRQHQRIHSGEKPYPCRECGKTFRESSQLIQHQRIHTGERPFECAECGKAFILISNL
TEHQRVHTGEKPHACAQCGKAFSQRSNLLSHQRIHTGEKPYACGQCGKTFKGSSGLVHHQ
RIHTGERPYACGDCGKTFRGSSELRQHQRLHSGEKPYVCGDCGKAFVRNSELISHQRIHT
GERPYACALCGKPFSHRSNLNEHQKRHTGRRASAEAEG
Download sequence
Identical sequences H9H9K3
ENSMODP00000027483 ENSMODP00000027483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]