SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027511 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027511
Domain Number 1 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 737-794
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.8e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 457-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 681-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.21e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 625-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 9 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 10 Region: 346-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 11 Region: 569-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 12 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 13 Region: 142-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027511   Gene: ENSMODG00000022841   Transcript: ENSMODT00000029051
Sequence length 837
Comment pep:novel chromosome:BROADO5:Un:5808290:5870502:1 gene:ENSMODG00000022841 transcript:ENSMODT00000029051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFERDRLPGQEAVTFQDVAVDFTREEWRLLSPPQKELYREVMLENAWNLLSVGLPASPE
DVLSSLEQREAPWMLEQEGLRSCCPGEPEIKVTPKEMSLSMKETDQQKFMSEDPYNFAWR
EFCVEYQHPSFIEHQRMHTEEKCSQCVKTFMQRATLAGHQRIHIDEKPYECNQCGKTFIR
SSNLARHQRIHTGEKPHACNQCGKTFSQSYYLVVHQRIHTGERPYECKQCGKTFKQSYKL
AQHQRIHTSEKPYECNQCGKTFRRSSHLAVHQRIHTDEKPYECQQCGKTFRRRSHLAGHQ
TIHTDEKPYECNQCGKTFRLRSYLAQHQRIHTGEKPYQCKQCGKIFRQSSNLAVHQRIHT
GRDLYECKQCGKTFSRNSGLTEHQRIHTGEKPYECKQCGKTFSRSFNLAEHQRIHTGEKP
YQCKQCGKTFRRGKHLAEHQRIHTGEKPYECNHCGKAFKCSSNLTNHQRMHTGEKPYECN
QCGKAFTQKASLAEHQRIHTGEKPYECNHCGKAFKCSSNLTSHQRIHTGEKPYECKQCGK
AFSQSSSLAEHQRSHTGEKPYECNQCGKAFTYNSSLSKHQRMHTGEKPYECSQCGKAFRS
SYHLRHHEKIHTGEKPYKCNQCGKAFTQKASLVKHQRIHTGEKPYQCNQCGKAFTYGSNL
TSHQRMHAGEKPYECNHCGKAFTQKTSLAEHQRIHTGEKPYECNHCGKAFKCSSNLTNHQ
RMHTGEKPYECNQCGKAFTQKASLAEHQRIHTGEKPYECNHCGKAFKCSSNLTSHQRIHT
GEKPYECKQCGKAFKAATILGIMRKFIQERNLINVINVERLSNVAPVLLNIRESTLG
Download sequence
Identical sequences H9H9N1
ENSMODP00000027511 ENSMODP00000027511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]