SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027512 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027512
Domain Number 1 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-27
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-27
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.65e-27
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-26
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-25
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-25
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 599-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 10 Region: 9-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.98e-18
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 11 Region: 98-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 641-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-16
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027512   Gene: ENSMODG00000022842   Transcript: ENSMODT00000029052
Sequence length 702
Comment pep:novel chromosome:BROADO5:Un:4361513:4401127:1 gene:ENSMODG00000022842 transcript:ENSMODT00000029052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALERDRRPAQELMAFKDVAVDFTREEWCLLSPPQKELYKEVMLENARNLFSVEGEIRPE
MTATPKEVSPNVEETGQQRFMSDGPDSLACREFAIESQNPSLIVHQTMHTSEKSSEHNQY
GKTFMHRTNLAVHQRIHTGEKAHECNHCGKTFNQSSSLAIHQRIHTGEKPYECNHCGKTF
NQSSNLAVHQRIHTGEKPYECKQCGKTFNHSSNLAIHQRIHTGEKPFECKQCGKTFSLSS
NLAVHQRIHTGEKPYECNQCGKTFNQSFCLAKHQRIHTGEKPYECNQCGKTFNQSSSLAI
HQRIHTGEKPYECNHCGKTFNRSSNLAVHQRIHTGEKPYECNQCGKTFRLRFDLAAHQRI
HTGEKPYECNQCGKTFNQSSSLAVHQRIHTGEKPYECKQCEKTFRLRFDLAAHQRIHTGE
KPYECKQCGKTFNQSSSLAIHQRIHTGEKPYECKQCGKTFRDSSNLAVHQRIHTGEKPYE
CNQCRKTFNQSSSLAVHQRIHTGEKPYECKQCGKTFRLRFDLAKHERIHTGEKPYQCNQC
GKTFNQSSSLAIHQRIHTGEKPYECNQCGKTFNQSSSLAIHQRIHTGEKPYECNQCGKTF
RDSSNLSGHQRIHTGEKPYGCNQCGKAFNQSSSLAIHQRIHTGEKPYECNQDEKTFRDSS
NLARSQRIHTGEKPYKCKQCGKAFKQIRSCCTSENLHWGETL
Download sequence
Identical sequences H9H9N2
ENSMODP00000027512 ENSMODP00000027512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]