SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027597 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027597
Domain Number 1 Region: 385-578
Classification Level Classification E-value
Superfamily Fibronectin type III 3.51e-39
Family Fibronectin type III 0.0000489
Further Details:      
 
Domain Number 2 Region: 676-867
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-38
Family Fibronectin type III 0.0000455
Further Details:      
 
Domain Number 3 Region: 883-1058
Classification Level Classification E-value
Superfamily Fibronectin type III 2.97e-37
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 571-671
Classification Level Classification E-value
Superfamily Fibronectin type III 1.71e-21
Family Fibronectin type III 0.0000184
Further Details:      
 
Domain Number 5 Region: 287-396
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000102
Family Fibronectin type III 0.0000739
Further Details:      
 
Domain Number 6 Region: 1056-1133
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000841
Family Fibronectin type III 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000027597
Domain Number - Region: 102-174
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00288
Family beta-sandwich domain of Sec23/24 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027597   Gene: ENSMODG00000004142   Transcript: ENSMODT00000029136
Sequence length 1208
Comment pep:novel chromosome:BROADO5:X:56402358:56469221:-1 gene:ENSMODG00000004142 transcript:ENSMODT00000029136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQVPTLEPTTVVNDMPLPPHMVNGDSMQQVILVQVNPGETFTIRTEDGHIQCIQGPAH
VPMMSLNGSMPPIFVPPGYMSQVVEENGVRKIVILPHSTDYHPAMHPPPHMQHYMHPHPP
PLLAHPMYPPVPGSELHPPQYMHQHPMPPPPPPPPPPPPPPPPPPLPQLRMYHEYESRSH
GRTHYIPRDERTGKMQEHLKKRIKDRHAIGHNNNNNKSGVPPSSLSKGQSSYNANAENGY
GKGQYVVEEPAKQKESGKAKDNAPEEAKAAEPEKEIKELQDLFSTGKPIVSNIQARSAVL
SWSHLVSSPNEEKASRPVSFTFEVALSNCGKSGKFKTIYIGDEVTVSLPDLQPATDYHVR
VSATYSSIEESTSEVISFTTESCEPDRPAVPKLVNRTKNSLILQWKGSNDNGSKIIGFLL
EWDEGKPGTFKECYFGHLKQYKLTKLAPSTKYSFRLAAKNNLGISEFSETVAFNTTGSVP
PAPPPPQLNQAGITTLSLDWSPPPGAATEESHFTYTLEMEEEGSGHGFKAKYNGEEPSCT
LKNLRRSTSYKFRLFAHNSEGKSNPSEEVEYTTYPDKPGPPSKPYTKGKIRAYNVKVAWD
PPKDNGGAEISKYVLEISEASNGNTWNVIYDGTLREHVCDHLRPGTSYKLRVFCFGIAGQ
SQASDILSIHTSAVPPGPCRSPYLANRAKPREISLHWAPPVVNGGAEIIDYVVDMAESDQ
AECRRVYQGPGLRCTVSNLLPGRTYSFWIKAANKTGFGPYSAKSQISTAPGPPDQCGVPL
LTCKTATSVAVSWEVPMCNGAEICDYRLEWGKLEGSMHVIYTGPCLNYEVKGLTPATTYF
CRVQAVNMAGIGMFGGTGIVTTPASVPGAMSLPRLLEGKIPLPLASTCLALQWDEPNCHG
SEITGYNIEYGERQIVTVDRVTSYTLENLQPDTVYRIRIQAINSLGQSPFSQSIKAKTKP
LPPDPPVLECVCFSYQSLKLKWGDGPNRISLSSSVQFNLQMEDKTGRFVTLLNGPCHTYK
VQRLSECTTYNFKIQAYNEAGEGPFSDIYTFTTTKSPPAALKAPKICQLEENLCEVTWEP
LPPMKGDSIIYILQLVSGRGADQVYKGPDTSFCFTNFQTNCEYRFRVCAGRQYQQNGGLQ
ELLGAYSPSTVFSSQKKDIDPPQDDDLIEENKSKKRCLTDDQFAFILVVAFAIIAVLCAV
AIQYFLIK
Download sequence
Identical sequences F6PHG0
XP_007507516.1.35504 XP_007507518.1.35504 XP_007507519.1.35504 XP_007507520.1.35504 XP_007507521.1.35504 XP_007507522.1.35504 XP_007507523.1.35504 XP_007507524.1.35504 ENSMODP00000027597 ENSMODP00000027597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]